PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010544757.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 328aa    MW: 36873.7 Da    PI: 9.7929
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010544757.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.37.5e-1370114147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +W+++E++++++a +++  + Wk+I + +g  ++  q++s+ qky
   XP_010544757.1  70 RESWSEQEHDRFLEALQLFDRD-WKKIEAFVG-SKSVIQIRSHAQKY 114
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.5E-1564120IPR009057Homeodomain-like
PROSITE profilePS5129414.90965119IPR017930Myb domain
TIGRFAMsTIGR015571.3E-1768117IPR006447Myb domain, plants
SMARTSM007175.0E-1069117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-569110IPR009057Homeodomain-like
PfamPF002491.1E-1070114IPR001005SANT/Myb domain
CDDcd001672.00E-772115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MVSVAPNSVR EHCLFDPIMK SGLSSRTPTA ETAAKAPGDC SPAAGGKNSL PFPEDSSKRT  60
RKLYTMTKSR ESWSEQEHDR FLEALQLFDR DWKKIEAFVG SKSVIQIRSH AQKYFLKVQK  120
NGTGEHVPPP RPKRKATRPY PQKAPKNVAA VSQPEGRFQA SAGSVELMES NKRMPLWIQN  180
SVAVVNTSPM ANGILDKERL YAPMVAKDSC YSSSNESAQK DRRFCEPNDQ LDKGRLIRVM  240
PDFSQVYSFL GSVFDPNATD HLQRLKQMDP INLETALLLM RNLNVNLNSS EFEKYWLSFY  300
GSKVKRSNSG PEYDDMQTGD RDRAVASA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010544757.10.0PREDICTED: protein REVEILLE 3-like isoform X1
SwissprotQ6R0H06e-89RVE3_ARATH; Protein REVEILLE 3
TrEMBLA0A061DUW21e-116A0A061DUW2_THECC; Homeodomain-like superfamily protein
STRINGPOPTR_0014s08520.11e-106(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12902893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01520.14e-68MYB_related family protein